SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOAG_17465T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOAG_17465T0
Domain Number 1 Region: 347-522
Classification Level Classification E-value
Superfamily Fibronectin type III 1.83e-18
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 2 Region: 82-179
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000044
Family Fibronectin type III 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOAG_17465T0
Sequence length 932
Comment | LOAG_17465 | Loa loa V3 hypothetical protein (933 aa)
Sequence
MSDASIGCYLVRFYCHSLRLRFLLTAAYSGSANNVPLRNARCTPDNWCVAKCCLSNYIFF
PRRNYTFQMSLFKTDAVGKITPLSEHVTALSWDGVSQKALELTLSRSSEDTLEISWEHPS
IDITNGFLQKYVIEYYKDSESLREVKRKDILPNSTICLLNGIKSEVVYRFRVIPVTRHGL
PSDVYLKSNPNFTSIGHMVESTNKNFRSVIGSLPIDIEQMGTSIIIHWEVRETSNFTSQD
PKNQAVLIRYAPSDLSPLREKAEEGLFINGAMNLTEKFDASRTYQFCSRLYDGLFYGPDF
CRTYRLPPATFADIFSSFSSGNGLPRAVLCHHRKECRCEPSYEFGDAMRVTWDWPIDDHS
ADEFVVHYTLSDSFFPEDDRLVITDEAFADLPSLRSNTTYRIMIEPRNKMGGVEGSWFNC
TTPILGQIPAPTGVMYEELNATAVRVSWNPIHPNPRWSTPVGYVIQVQSSSTSMAPVKDI
LVDGISATSHVITLQPNMLYTFQVAARSNAGDLGQRSSPYLFAPSQISKPGRIDVRRPKM
FPKSSREGILIGIVLVVGLLTLCFGGICAHLRLKRRKLEMGINANAANRGTNGSRNITNY
EMESLITRRRSELIDAPGRNIPRDSLMHNQLNPQNSISNEVEVICLDTKGGEQGALPSGQ
DKYLRLLNDKKQLQRFKECFLFNGLSEESSVKSHISCRKKTKNVNRRNEPFTIMAKRSNY
KLLDSKWIRAACDTSDPWTGSLPSKKRVVRLGSTSTRTVKTCYLMTGRMSISNFDIMMPR
FLSKLTALSDNTRRNAASHVESLNQAISYTSIICPRSASVQSLYQRNGFIKQKNDSVKTS
VAITTNNYMNYPCNTPSSQSLTWYDAGSIENDGIMRLPRDTPKLHGNSNKGATMLCCSMP
NLTDSGIVYDEMHFPRPPPLSPPPLDNKHLEK
Download sequence
Identical sequences A0A1S0UIL2
XP_020306243.1.37734 LOAG_17465T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]