SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOAG_18698T0 from Loa loa v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOAG_18698T0
Domain Number 1 Region: 688-803
Classification Level Classification E-value
Superfamily TPR-like 0.00000000027
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 
Weak hits

Sequence:  LOAG_18698T0
Domain Number - Region: 605-716
Classification Level Classification E-value
Superfamily TPR-like 0.00493
Family Tetratricopeptide repeat (TPR) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LOAG_18698T0
Sequence length 951
Comment | LOAG_18698 | Loa loa V3 eukaryotic translation initiation factor (952 aa)
Sequence
MAVVDGNVVAINPADEPRTHMYIWNNIFFSLGFDVKDHYKELGGDAAAHAATSNDLQGVR
AYAQLDNAKLFTLGMVIVDYKGFRVTAQSIIPGILEREQEQSVVYGSVDFGKTVVSSEEY
HDLLSKPAEQLKILPHEVYNGKDDGKIIKLCSSFETKGIVGNDLRHYILDLLRTFPPDVN
YLEDAEVTDICKANGYPRAFPHKLASLRQELIEAFVECRYLMFIRIAAYHVQQTRLGLLA
TEDDDGTNEAKQKEDAILKVDRFSETMQEDAIINQIKSEIVADMKVDEMPLLETETAKKI
MKEAIDNDEKKADGLDKEISEQIMAKAAKAVGSIRTDAFDIRFNPDCYCSTVRHAENEDI
AKQRRLVAEAAEFLIVQQLPNFVRDCLQRTIMPLDGASLSDSLHSRGINIRYLGKLTQYI
QSIQRLTYLKVICITELLCRCAKHIFRSYLQPVSSAHTATAVSHFLNCLLSPSTEPITSS
NEEMSLSIIGVKKSRSSKRRKQINNGGKENDDWVQMSSNRLWERVKSDADFYYAFKINEE
NVDAYLSTTGIQKISFLRRFAQIVGIQMLLRDYNLEAGKKSQLFVEDDIQGLYCQAKHVD
PKAVDAHSLFLSGQTKVQQGHLRAGFDLVLESLNLMNTVYGAMHSDMVKCMRLLARLSYI
LGDPPEALSQQHKATLMSERCNGLDSANTVIEYLNLAHFSFANLHIAAALKLLYRARYLL
LLIHGENHPFMAEIDGNIGVILYAVQEFDDALKFLQNALKLHQTYMEPQTLKTALIYHLL
ARTYSCRGDFRTALQMERETFTIYSKTFGNDHEKTKESSECLKHLTQQAVTFQKRINEAN
RQGSNNIGQLLPVEIHRPSLHSVLEILNILNGIIFIQLRGISTSSEVNEGNDELENSINN
NKILEDATSSIKKNENSDDIAVVSSRSQMDNISAIVSGSSTAQTMQEVALD
Download sequence
Identical sequences A0A1S0UEB2
LOAG_18698T0 XP_020304860.1.37734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]