SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482893648|ref|YP_007893741.1| from Azotobacter vinelandii CA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482893648|ref|YP_007893741.1|
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.0000000000445
Family TTHA0281-like 0.05
Further Details:      
 
Domain Number 2 Region: 72-112
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0000945
Family Omega transcriptional repressor 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|482893648|ref|YP_007893741.1|
Sequence length 113
Comment HicB protein [Azotobacter vinelandii CA]
Sequence
MSNLLNHRGYYGSVEVSPADNCLFGKLLFIRALVSYEGETVAELTAAFRAAVDGYLADCE
ALGRTPEIPCKGSFNVRVGHELHMAASLAASRQNITLNDLTRRALSEYIAHHT
Download sequence
Identical sequences C1DKV4 M9YC38
gi|482898142|ref|YP_007898790.1| 322710.Avin_27840 gi|482893648|ref|YP_007893741.1| gi|226944858|ref|YP_002799931.1| WP_012701344.1.101714 WP_012701344.1.69821 WP_012701344.1.78925 WP_012701344.1.92556 WP_012701344.1.99604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]