SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|482894826|ref|YP_007894016.1| from Azotobacter vinelandii CA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482894826|ref|YP_007894016.1|
Domain Number 1 Region: 1-74
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 2.49e-17
Family TTHA0281-like 0.035
Further Details:      
 
Domain Number 2 Region: 69-107
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.000017
Family VCA0319-like 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|482894826|ref|YP_007894016.1|
Sequence length 110
Comment Conserved hypothetical protein, HicB- family [Azotobacter vinelandii CA]
Sequence
MNTMTCKGYAARIEYSDEDGLFVGHIAGIRDVVGFHGETVKELRSAFAEALDDYLETCAR
LNRPAQKPYSGKLSLRLTPELHASVAVKAQLANQSINQWVSEVLSREAHA
Download sequence
Identical sequences C1DN64 M9YJS1
WP_012701617.1.101714 WP_012701617.1.69821 WP_012701617.1.78925 WP_012701617.1.92556 gi|482901118|ref|YP_007899065.1| gi|226945133|ref|YP_002800206.1| gi|482894826|ref|YP_007894016.1| 322710.Avin_30660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]