SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374308174|ref|YP_005054605.1| from Filifactor alocis ATCC 35896

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|374308174|ref|YP_005054605.1|
Domain Number - Region: 184-244
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0016
Family Capz alpha-1 subunit 0.013
Further Details:      
 
Domain Number - Region: 136-179
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.0493
Family PepSY-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374308174|ref|YP_005054605.1|
Sequence length 272
Comment peptidase propeptide and YPEB domain protein [Filifactor alocis ATCC 35896]
Sequence
MKTNKKTKVISALLISGAIGLTLLSAPFSAFADTVKSTIGTQKAKTIALNDAKVKSSNAR
FVTAKLDREDGRIVYDIEFYVGNREYDYEIDAYTGRILSKDADIEYVAPKAVTKKQQGNI
GIAKAKNIALNDAKVKASNARFVTAKFDIEDGKQVYEVEFYVGNKEYDYVIDAGTGRILE
KDTDLENDVIVTAPSKTQGGKYIGAEKAKSIALNHSKKKASDVSFVKTELDQDDGRVVYD
IQFYFGNKKYNYEIDATTGKILSYEEDNVDFD
Download sequence
Identical sequences D6GTI5
WP_014262517.1.100256 gi|374308174|ref|YP_005054605.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]