SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347536318|ref|YP_004843743.1| from Flavobacterium branchiophilum FL-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347536318|ref|YP_004843743.1|
Domain Number 1 Region: 1-205
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.94e-58
Family PP-loop ATPase 0.0000289
Further Details:      
 
Domain Number 2 Region: 344-431
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000000445
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|347536318|ref|YP_004843743.1|
Sequence length 436
Comment tRNA(Ile)-lysidine synthase [Flavobacterium branchiophilum FL-15]
Sequence
MENKFKQIIKNKLPFLEGKKILLAVSGGLDSMVLTDLFIKTKFSIAIAHCNFNLRDTESQ
GDQEFVATFCTNKHIPLFVKSFETLQFANDNKLSTQVAARNLRYEWFQNILKQHEIDFIA
TAHHADDNLETFIINLSRGTGIDGLKGMPFYNNNIVRPLLYFSRENIQNYALKNNIQWRE
DSSNASDKYLRNKIRHQIVPILKELNPSFLNNFQKAQLFLDDTQTLAKDAATLLFEKLTL
MQNGVIYFDLVAIKKLPNFKAYLYYWLKDYGFKAWTDIFDLIDSQTGKQVFSKEFQLLKN
REQLILKPISETINSFFWIDKNQTKVNFPLNLDISKVDCISNSKNNTIFVDADQLKFPLC
IRKWQLGDIFFPKGMKGKSKKISKYFKDEKFSALDKESTWLLCSDDQIVWVIDKRQDERF
AANNNTINILQIKSNL
Download sequence
Identical sequences G2Z0W1
WP_014083973.1.101872 gi|347536318|ref|YP_004843743.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]