SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347537137|ref|YP_004844562.1| from Flavobacterium branchiophilum FL-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347537137|ref|YP_004844562.1|
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 3.35e-48
Family Deoxycytidylate deaminase-like 0.0000696
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347537137|ref|YP_004844562.1|
Sequence length 147
Comment putative cytosine/adenosine deaminase [Flavobacterium branchiophilum FL-15]
Sequence
MIQPFDDHYFMKKALEEAEIAFEKGEVPVGAVIVIQNKIIARSHNLTELLHDVTAHAEMQ
AITAAANYLGGKYLTNCTLYVTLEPCQMCAGALYWSQISKIVFGAPDVKRGFETLQTQIH
PKTTIVRGIMQHEASALMKRFFENKRK
Download sequence
Identical sequences A0A226GKD1 G2Z2Z2
gi|347537137|ref|YP_004844562.1| WP_014084787.1.101872 WP_014084787.1.9578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]