SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471327555|ref|YP_007526585.1| from Streptomyces davawensis JCM 4913

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471327555|ref|YP_007526585.1|
Domain Number 1 Region: 2-367
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.55e-115
Family FMN-linked oxidoreductases 0.00000000205
Further Details:      
 
Domain Number 2 Region: 333-518
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.06e-43
Family N-terminal domain of adrenodoxin reductase-like 0.00000989
Further Details:      
 
Domain Number 3 Region: 468-626
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.02e-21
Family C-terminal domain of adrenodoxin reductase-like 0.0000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|471327555|ref|YP_007526585.1|
Sequence length 671
Comment 2,4-dienoyl-CoA reductase [NADPH] [Streptomyces davawensis JCM 4913]
Sequence
MSRYPHLLSPLDLGFTTLPNRVLMGSMHVGLEEAERGFERMAAFYAERARGGVGLIVTGG
IAPNDEGRPYEGGAKLTTDAEAEQHRVITDAVHAEGGRIAMQILHFGRYAYHQDLVAPSP
IQAPISPFPPRELTDADVERTIEDYACAARLARQAGYDGVEIMGSEGYLINEFIVAQTNH
RTDRWGGSYENRMRFPVEIVRRVREAVGEDFIIVYRLSMLDLVPGGSTLDEVITLAKAVE
EAGATIINSGIGWHEARIPTIATSVPRGAYTWVTKRLMGEVSVPLVTTNRINTPELAEEL
LADGYADMVSMARPMLADPEFVNKAAEGRPEAINTCIGCNQACLDHTFSLKITSCLVNPR
ACHETELVLSPTRLAKRVAVVGAGPAGLACAVSAAERGHQVTLFDAASEIGGQLNVARQV
PGKQEFDETLRYFRHQLDARGVDVRLNTPVAAADLDGYDEVVVATGVTPRTPDIPGVDHP
SVVGYLDVLRDKAPVGERVAILGAGGIGFDVAEFLTDGGDKANEDPETYFRHWGVDMDYE
GPGGLGAPERPEPPRTVHLLQRKTTKVGAGLGKTTGWIHRTELKHRGVTMVPGVRYDRID
DAGLHVTVGEESTVLPVDTIVLCTGQEPRRDLYEELVAAGRSAHLIGGADVAAELDAKRA
IQQGTEVAAAL
Download sequence
Identical sequences K4RF55
WP_015662784.1.64236 gi|471327555|ref|YP_007526585.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]