SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471321759|ref|YP_007520789.1| from Streptomyces davawensis JCM 4913

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471321759|ref|YP_007520789.1|
Domain Number 1 Region: 29-208
Classification Level Classification E-value
Superfamily E set domains 1.33e-42
Family E-set domains of sugar-utilizing enzymes 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|471321759|ref|YP_007520789.1|
Sequence length 301
Comment secreted cellulose-binding protein [Streptomyces davawensis JCM 4913]
Sequence
MTRTRARFATAVAAPVLLALWAATPAAAHGAPTDPVSRVMACSPEGGPDARSAACRAAVA
ANGSPFTAWDNLRIANVNGRDRQIVPDGELCSGGLPAYRGLDLARVDWPSTRLNPGAALT
MRYVSTIPHTGTFRLYLTEQGYDPTRPLSWSDLPEQPFAEVRDPALTNGAYSIRATLPKD
RTGRHVLYTVWENSSTPDTYYSCSDVVFPETKPEPETTTRKPESAKKPSAGESTKKPETT
QPTESPEVARSPDSSPVAQSRTAATTSAPDSGPSAPLLAGGAAAVLLLTGGAALAVRLRR
R
Download sequence
Identical sequences K4R0H1
WP_015657056.1.64236 gi|471321759|ref|YP_007520789.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]