SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471326296|ref|YP_007525326.1| from Streptomyces davawensis JCM 4913

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471326296|ref|YP_007525326.1|
Domain Number 1 Region: 34-215
Classification Level Classification E-value
Superfamily E set domains 7.7e-50
Family E-set domains of sugar-utilizing enzymes 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|471326296|ref|YP_007525326.1|
Sequence length 322
Comment cellulose-binding protein [Streptomyces davawensis JCM 4913]
Sequence
MPARRRVATAASVAFVGVAPLVLTALGAAPAAAHGSMGDPVSRVSQCYAEGPESPKSDAC
KAAVAAGGTQALYDWNGIRIGDAAGRHQELIPDGKLCSAGSDAFKGLDLARADWPATAVS
SGSYTFKYRVTAPHKGTFKVYITKEGFDPAKSLAWDDLDLQNPVATVTDPAASGGFYTFS
GTLPKRSGKQVLYAVWQRSDSPEAFYSCSDVTFGGASTGGDGGSTPAPSASAPSEEQIED
GADESTVEHNGHGDQDASTSAEPVAKTEANQPKAAGTTENLAETGGDSSTSYIAMGGAAA
LALGAAALFMSVRRRATDGTRR
Download sequence
Identical sequences K4RDY4
WP_015661533.1.64236 gi|471326296|ref|YP_007525326.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]