SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|452944682|ref|YP_007500847.1| from Hydrogenobaculum sp. HO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452944682|ref|YP_007500847.1|
Domain Number 1 Region: 25-93
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.0000000000000852
Family 2Fe-2S ferredoxin-related 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|452944682|ref|YP_007500847.1|
Sequence length 96
Comment ferredoxin [Hydrogenobaculum sp. HO]
Sequence
MAKLIVNKKVIGNFDVGTKFQDIHDLIEKAGVEFGCTDGQCGVCVATVLRGLEALNEVSE
KESDTLWRIGEYDEDRRLTCQLEIVKDTDVIELQTD
Download sequence
Identical sequences B4U621 M1RLR3
380749.HY04AAS1_1528 gi|452944682|ref|YP_007500847.1| 2014012734 WP_012514567.1.45798 WP_012514567.1.67077 WP_012514567.1.67908 WP_012514567.1.87448 WP_012514567.1.9515 gi|471265050|ref|YP_007647904.1| 2014295685 gi|195953899|ref|YP_002122189.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]