SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383450608|ref|YP_005357329.1| from Flavobacterium indicum GPTSA100-9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383450608|ref|YP_005357329.1|
Domain Number 1 Region: 19-226
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.03e-54
Family PP-loop ATPase 0.0000539
Further Details:      
 
Domain Number 2 Region: 336-428
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000000000196
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383450608|ref|YP_005357329.1|
Sequence length 435
Comment tRNA(Ile)-lysidine synthase [Flavobacterium indicum GPTSA100-9]
Sequence
MFINFKDHIESNFPFLLKSNLLIAVSGGVDSMVLLHLLDKINLNISVAHCNFQLRAEESK
EEENFVKTYCEEHQIHLFVKRFATKEYAIQNKLSIQLAARELRYDWFNLVMKENNFDFLL
TGHHLDDQVETFLINFTRGTGIEGLTGIPAINNNIIRVLLPFSREAILNYATENNLQWKE
DSSNASDKYFRNKIRHQVIPVLKELNPNFLESFKNTLIHLKTTEQIVNKYSIETLNKLIQ
VKDNKEFIKISELSKINDYTFYLYQWLKEYGFTAWKDIYQLIQAQTGKQIYSPTHILVKN
RDELILSSISKPNDAIYFIPSIDEELKFPLKLTLCNLSYINEQNKNSIFVDADKIQFPLI
VRKWKEGDVFYPLGMNGSKKVSKFFKDEKFSLFDKQNTWILESNNNIIWIIGYRQDDRFK
INETTQTTIKIEFLK
Download sequence
Identical sequences H8XPJ8
gi|383450608|ref|YP_005357329.1| WP_014388397.1.21237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]