SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392396605|ref|YP_006433206.1| from Flexibacter litoralis DSM 6794

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392396605|ref|YP_006433206.1|
Domain Number 1 Region: 113-222
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000209
Family FCH domain 0.051
Further Details:      
 
Weak hits

Sequence:  gi|392396605|ref|YP_006433206.1|
Domain Number - Region: 33-90
Classification Level Classification E-value
Superfamily Ribosome binding protein Y (YfiA homologue) 0.0262
Family Ribosome binding protein Y (YfiA homologue) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392396605|ref|YP_006433206.1|
Sequence length 225
Comment hypothetical protein Fleli_0961 [Flexibacter litoralis DSM 6794]
Sequence
MKKINIYLFAFVLFTFSMFSVAASAQNVSEKAIKVEKKKSLNGFEIQFDGMSEDAEEALH
MAIDKWLDTQKIKYKEKKGNYHATEVIVKEFSDKTSDLHIFVDEKKGQITLQVVQTLGYD
MAVSTQTQPQAAQNIRAWLENMVKEVRLEQINLQLAALQNNLKDAEKEVAKNQKTDENLK
KDIEDYKKKIADAENDIEKNTASQKENEQKRDELKLKITELEKMK
Download sequence
Identical sequences I4AHH8
WP_014796871.1.630 gi|392396605|ref|YP_006433206.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]