SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392396752|ref|YP_006433353.1| from Flexibacter litoralis DSM 6794

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392396752|ref|YP_006433353.1|
Domain Number 1 Region: 242-585
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.78e-69
Family beta-Lactamase/D-ala carboxypeptidase 0.0004
Further Details:      
 
Domain Number 2 Region: 54-239
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 9.16e-21
Family Penicillin binding protein dimerisation domain 0.0073
Further Details:      
 
Domain Number 3 Region: 656-709
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000366
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392396752|ref|YP_006433353.1|
Sequence length 710
Comment cell division protein FtsI/penicillin-binding protein 2 [Flexibacter litoralis DSM 6794]
Sequence
MAKTGIRKYILARVRIAFLVVAFIALVIVYKMMTIQIVEGEKWSSKARGVEMRDVQPTRG
SILADDGSLLATSLPFYRVAIDPTVADSTVFNEGIDSLGILLSKFYKEEEPSYYVNLLRE
YRKNNKKYYVISKELIDHENYKKLSQFPIFREGRNKGGVIYEQTDRRFLPFGELARRTIG
FVTEEDTTQSLNGRGLEYSFNSELQGVAGEALYELIAGGFWKPVDDMSQVRPKPGIDIQT
TIDINLQDTVHQILQNALRQYKAEYGSVILMEVATGEIKALVNLGINSNGSYVENNNYAV
GDMGLAEPGSTFKLMSMAALFEDKEVPISLKDSVQTGDGVHKYYDDAVMRDVSGLGKLTV
QEVFEKSSNVGMSLLVWKYFRKHPEKYVEHLKKFGLNRPLGFQMAGEAQPYIKSPTDSSS
SWSGSTLPWMSIGYELKLAPLQTLAFYNMVANNGVMVEPIIVSQTRQAGKTLTSFDAKVL
NNQTISKKTVKILQTMLRGAVENGTAKKIDTKVYQIAGKTGTAEKVRNGEYTEDHYTSFA
GYFPADNPKYSCIVVIDDPKTEKRYASEVAAPVFRKISDVVYQRYLHKPLSEVEPTAMDS
LHMRLPFIRAGYRPDLDLVCSQLGIKTENLTVQQWVKTKVATDTVMWIDNQAATSLVPDV
RGMRLRDALYLLENLGMKVAFEGKGRIITQSFNPNIAIPKGKTIYLKLKE
Download sequence
Identical sequences I4AHX5
gi|392396752|ref|YP_006433353.1| WP_014797017.1.630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]