SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392398114|ref|YP_006434715.1| from Flexibacter litoralis DSM 6794

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|392398114|ref|YP_006434715.1|
Domain Number - Region: 67-129
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000366
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392398114|ref|YP_006434715.1|
Sequence length 279
Comment hypothetical protein Fleli_2558 [Flexibacter litoralis DSM 6794]
Sequence
MDTNSFKNRIDNINFKEIKHKLHYYLTRNHYSTLLIHLGLMGVLVAFILYSFFYIYLPST
TNHDITIRVPDLNKMKLEEVEKFLEKRDLRYEIADTSYNPDYPPLTVLQQNPAENAPVKI
HRKIYLTINSETPPKTRIPQIIDFPYTSAHTQLKNVKLKMGKPEYVTNSARNVVLKIAVN
GKEYTKADLEKGVYIPQGTEVTLFIASGSVNDDFKMGNYIGQHAENFKLELEGNGIIVEI
HDQKAEGKEAGTVISQKPSAGNRIVVGQTVELWVVPYYN
Download sequence
Identical sequences I4ALT7
WP_014798359.1.630 gi|392398114|ref|YP_006434715.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]