SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392395818|ref|YP_006432419.1| from Flexibacter litoralis DSM 6794

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392395818|ref|YP_006432419.1|
Domain Number 1 Region: 44-377
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.9e-101
Family Cystathionine synthase-like 0.000000633
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392395818|ref|YP_006432419.1|
Sequence length 379
Comment cystathionine beta-lyase/cystathionine gamma-synthase [Flexibacter litoralis DSM 6794]
Sequence
MKKSTQCVHSGTYFDEKSGGVNTPIFTSTAYTYNDAASISYPRYFNTINQEVVAQKIAAL
ERGEAALIFSSGMAATMTALLGVLEAGDHLILQNDIYGGTHYAVSEQLSKIGIESTFVEG
RKVEDFEKAIKPNSKAIFIETPSNPLLLLVDIAEMANFAKENNLISVIDNTFGTPIFQNP
LRLGIDIVIHSGTKYLAGHSDLSCGAVVTSQKMIEKIHHVAFNFGGNLDSMATSLLERSL
KTLAIRVKTQAQNAQKIAETLQKLPQIKKVFYPGLESHPDHEIAKKQMKDGFGAMLSFEL
DTDAEGRAKFVRHLELICKALSLGGVESTLTEPSLTSHSKIPADMRKRMGITDNLYRLSV
GIEDADDLIEDLTNAIQTL
Download sequence
Identical sequences I4AF91
WP_014796094.1.630 gi|392395818|ref|YP_006432419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]