SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392399051|ref|YP_006435652.1| from Flexibacter litoralis DSM 6794

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392399051|ref|YP_006435652.1|
Domain Number 1 Region: 9-389
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.15e-117
Family GABA-aminotransferase-like 0.00000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392399051|ref|YP_006435652.1|
Sequence length 390
Comment UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase [Flexibacter litoralis DSM 6794]
Sequence
MTTTTTFSIPYGKQNITQDDINAVVETLQADFLTQGPKIDEFETKFADYVGSKYAVAVSN
GTAALHLCALALNVNEKSKVITTPITFAASANCIKYCGGEVIFADIDPKTALIDLEKLEE
LLKSNPKGTFDGIIPVDFMGLPVDLEKVKKLAEEYGLWIIEDACHAPGGYFIDSKNKKQN
CGNGNYADLAIFSFHPVKHIASGEGGMVTTNDKNLYDKLIKLRTHGITKNPDLLQENHGG
WYYEMQELGYNYRIPDILAALGVSQLSRAEEMMQKRQEIAKRYDEAFKDTKIQFFQYPKD
SIFHAYHLYVIQIEDRKGLYDYLRENNIFAQVHYIPVHTMPYYQTLGHKKGDFPSAENYY
KSCLSLPMYPTLTEEEQNFVIEKILEFVGK
Download sequence
Identical sequences I4APH4
gi|392399051|ref|YP_006435652.1| WP_014799284.1.630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]