SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392399518|ref|YP_006436119.1| from Flexibacter litoralis DSM 6794

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392399518|ref|YP_006436119.1|
Domain Number 1 Region: 12-412
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.38e-109
Family GABA-aminotransferase-like 0.00000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392399518|ref|YP_006436119.1|
Sequence length 419
Comment ornithine/acetylornithine aminotransferase [Flexibacter litoralis DSM 6794]
Sequence
MLSSRQLFLNHVAQTSPFPLALEVHNAKGIYMFGSKNKKWIDIISGIGVSNVGHRHPKVI
KAIQKQLKKYMHLMVYGEFIQTPQVLLATALSKTFPATLGESFLDKKNENYNADIAQNAT
YFVNSGSEAVEGAIKLAKRFTKRTQLIGCHNAYHGSTHAALSLGTSKEWKEPFLPLLPDI
DHINFNEEAHLSKITEKTAAVIIETVQGEGGVRIPEKSYLQTLRKKCTETGTILICDEIQ
CGFGRTGKLWAFEHFDIIPDIVVAAKAMGGGMPIGAFMASQQMMACLSDNPILGHISTFG
GHPVSCVASLATLKVIQEEKLLDSIEEKHELFKKLLSPKTTKAIKEFRGIGLMLAVEFES
FEFLQKVIAHCLDLGLLSDWFLYCDNSMRIAPPLIITKKEIKKACKIILEAIQLTEENR
Download sequence
Identical sequences I4AQU1
gi|392399518|ref|YP_006436119.1| WP_014799749.1.630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]