SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2035957098 from Fungus garden combined (combined)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2035957098
Domain Number 1 Region: 2-93
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.83e-21
Family ArsC-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2035957098
Sequence length 94
Comment AECFG_632680 Arsenate reductase and related proteins, glutaredoxin family [Fungus garden combined (combined)]
Sequence
IGIDPNIVLYLDTPPDATTIRQILTMLGMSSARELMRQKEDLYNSLNLADSCLNEDELIQ
AMVENPKLIERPIVISHGQARIGRPPEDVLEIVS
Download sequence
Identical sequences 2035957098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]