SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2035968716 from Fungus garden combined (combined)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2035968716
Domain Number 1 Region: 2-186
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.02e-54
Family Glutathione peroxidase-like 0.000000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2035968716
Sequence length 187
Comment AECFG_821680 peroxiredoxin [Fungus garden combined (combined)]
Sequence
MSLIGKEVEHFVTEAYQNGKFLTVNSDDLKGKWNVIVFYPADFSFVCPTELEDLQEQYGI
LKDLGVEVYSCSTDTHFVHAAWHEHSEAIGKVEYPMLADPSQKISRIFDVLDEESGLSQR
GSFIIDPDGVVQAVEITADGIGRDASQLVDKVRAAQYIRKNPGEVCPAKWKEDAETLTPG
LDLVGKI
Download sequence
Identical sequences A0A1I4ESE7 F9VDW9 V8AS81
gi|385833029|ref|YP_005870804.1| 2031844759 WP_004257218.1.10846 WP_004257218.1.1157 WP_004257218.1.14101 WP_004257218.1.2391 WP_004257218.1.3073 WP_004257218.1.43393 WP_004257218.1.43746 WP_004257218.1.4860 WP_004257218.1.86839 gi|347521586|ref|YP_004779157.1| 2035968716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]