SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2035990654 from Fungus garden combined (combined)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2035990654
Domain Number 1 Region: 1-73
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.00000000000902
Family Crotonase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2035990654
Sequence length 74
Comment AECFG_1185260 short chain enoyl-CoA hydratase (EC 4.2.1.17)/3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) [Fungus garden combined (combined)]
Sequence
MNTLKAEFVPQIKAVLAEARSNPKLAGLVLISGKXDNFVAGADISMIADCQTAEEAEALA
RQGQEVMARLRRCL
Download sequence
Identical sequences 2035990654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]