SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2036003183 from Fungus garden combined (combined)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2036003183
Domain Number 1 Region: 6-77
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.68e-19
Family Thioltransferase 0.000086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2036003183
Sequence length 84
Comment AECFG_1392880 ribonucleoside-diphosphate reductase class Ib glutaredoxin subunit (EC 1.17.4.1) [Fungus garden combined (combined)]
Sequence
MEIRIMSIIIYTRNDCVQCHATKRAMESRGVAFEMVNIDLVPDAGDTLREQGFRQLPVVV
AGDTSWSGFRPDMINRLSAQATRA
Download sequence
Identical sequences 2036003183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]