SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2036010188 from Fungus garden combined (combined)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2036010188
Domain Number 1 Region: 1-257
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.36e-95
Family Biotin dependent carboxylase carboxyltransferase domain 0.00000000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2036010188
Sequence length 258
Comment AECFG_1506930 acetyl-CoA carboxylase carboxyltransferase subunit alpha [Fungus garden combined (combined)]
Sequence
QVAQLARHPMRPYTLDYIRHAFDDFDELAGDRAYADDKAIVGGIARLDGRPVMIIGHQKG
RETKEKIRRNFGMPAPEGYRKALRLMEMAERFNMPVITFIDTPGAYPGVGAEERGQSEAI
ARNLREMSGLKVPVICTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKSA
DKAPLAADAMGITANRLKELDLIDTVVPEPLGGAHRHPEIIAESLKQQLLSDLAELDALS
QEQLLDRRYQRLMNYGYA
Download sequence
Identical sequences 2036010188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]