SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2035950301 from Fungus garden combined (combined)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2035950301
Domain Number 1 Region: 92-338
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.33e-80
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000488
Further Details:      
 
Domain Number 2 Region: 13-99
Classification Level Classification E-value
Superfamily tRNA-binding arm 1.88e-22
Family Phenylalanyl-tRNA synthetase (PheRS) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2035950301
Sequence length 338
Comment AECFG_522190 phenylalanyl-tRNA synthetase, alpha subunit (EC 6.1.1.20) [Fungus garden combined (combined)]
Sequence
MENLDALVSQALEAVERAEDINTLEQIRVNYLGKKGELTQVMKTLGNLPAEERPKVGALI
NDAKERVTVVLNARKAAFEEAELSARLAAECIDVTLPGRGQATGGLHPITRTLERIEQFF
THIGYGIAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMES
TQPPIRIVCPGRVYRCDSDITHSPMFHQVEGLLIDRDINFADLKGTIEEFLRVFFEKELA
VRFRPSFFPFTEPSAEVDIQCVMCSGKGCRVCKQTGWLEVMGCGMVHPNVLRMSGIDPEE
FQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLAQFR
Download sequence
Identical sequences A0A059UZU9 A0A099MZC3 A0A0C1KKG3 A0A0M2ULX2 A0A136QN20 A0A1L5PNX5 F8G062 L0FIR7 V9V0K0
WP_013972006.1.1643 WP_013972006.1.23948 WP_013972006.1.28354 WP_013972006.1.32670 WP_013972006.1.35335 WP_013972006.1.35716 WP_013972006.1.36363 WP_013972006.1.41505 WP_013972006.1.42658 WP_013972006.1.52768 WP_013972006.1.56258 WP_013972006.1.57632 WP_013972006.1.59340 WP_013972006.1.61620 WP_013972006.1.65739 WP_013972006.1.71677 WP_013972006.1.7288 WP_013972006.1.7435 WP_013972006.1.76710 WP_013972006.1.80759 WP_013972006.1.92076 WP_013972006.1.9402 WP_013972006.1.95946 WP_013972006.1.98117 WP_013972006.1.99927 gi|568181469|ref|YP_008954021.1| 2035950301 gi|339486953|ref|YP_004701481.1| gi|568186848|ref|YP_008959391.1| gi|431801953|ref|YP_007228856.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]