SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2035964912 from Fungus garden combined (combined)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2035964912
Domain Number 1 Region: 2-257
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.46e-90
Family Crotonase-like 0.000000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2035964912
Sequence length 257
Comment AECFG_761770 short chain enoyl-CoA hydratase (EC 4.2.1.17) [Fungus garden combined (combined)]
Sequence
MAFETILLDIHGKVGLITLNRPQALNALNAQIVGEINQALDQLERDPNIGCVVLTGSAKA
FAAGADIKEMAELQYPQIYVDDLFSDSDRIANRRKPIIAAVSGFALGGGCELAMMCDFIL
AADNARFGQPEINLGVLPGMGGTQRLTRAVGKAKAMELCLTGRLMGAEEAERAGLVARIV
PQAELVEEALKVAATIASKSIPVSMMVKESVNRAFEVTLSEGVRFERRVFHAAFATEDQK
EGMAAFIAKREAQFKDR
Download sequence
Identical sequences A0A059UVJ4 A0A1L5PLI1 A0A2A3M192 F8FW64 L0FI70 V9UYJ5 V9WUD0
gi|568186631|ref|YP_008959167.1| gi|431801753|ref|YP_007228656.1| gi|568181200|ref|YP_008953738.1| gi|339486750|ref|YP_004701278.1| 2035964912 WP_013971834.1.23948 WP_013971834.1.28354 WP_013971834.1.32670 WP_013971834.1.35335 WP_013971834.1.41505 WP_013971834.1.52768 WP_013971834.1.56258 WP_013971834.1.59340 WP_013971834.1.61620 WP_013971834.1.65739 WP_013971834.1.71677 WP_013971834.1.7288 WP_013971834.1.76210 WP_013971834.1.76710 WP_013971834.1.92076 WP_013971834.1.9402 WP_013971834.1.95946 WP_013971834.1.99927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]