SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2035992408 from Fungus garden combined (combined)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2035992408
Domain Number 1 Region: 81-203
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.85e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.0026
Further Details:      
 
Domain Number 2 Region: 1-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.45e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2035992408
Sequence length 207
Comment AECFG_1214550 Glutathione S-transferase [Fungus garden combined (combined)]
Sequence
MLKIWGRKNSSNVRKALWIAHELGLDFESIDAGGAFGVVNEPHYRARNPNGLVPMLEDGD
LTLWESNTIVRYLCAEYGAEQGWYLDDPRQRALADKWMDWTTSSFATPFRPLFWGLLRTP
EDQRDWVAINAAHKQCAQLLAIADEALAKQPYLSGDQIGMGDIPLGSFIYAWFEMPIERP
AMRHLEAWYERLKARPAYQAAVMTALT
Download sequence
Identical sequences A0A059UQX5 A0A0B5KHB1 V9UW43
gi|568186374|ref|YP_008958905.1| gi|568180943|ref|YP_008953476.1| WP_024086519.1.23948 WP_024086519.1.28354 WP_024086519.1.35335 WP_024086519.1.65739 WP_024086519.1.80759 2035992408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]