SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336323848|ref|YP_004603815.1| from Flexistipes sinusarabici DSM 4947

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336323848|ref|YP_004603815.1|
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily AF1862-like 1.07e-28
Family Cas Cmr5-like 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336323848|ref|YP_004603815.1|
Sequence length 140
Comment Cmr5 family CRISPR-associated protein [Flexistipes sinusarabici DSM 4947]
Sequence
MRTLGQKRAEYALEKVLTISCDKKDFKSLSSGVPSMILQNGFGQTMAFLVAKGTDKDMKI
KENDKHIVMFRIIKEWLIKELSTVGFNKNNNEKEFIKEISQLSQMDYLTAQKETLALLEW
VKRYANAWFSGEESKNDTGS
Download sequence
Identical sequences F8E945
gi|336323848|ref|YP_004603815.1| WP_013886726.1.54234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]