SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336323954|ref|YP_004603921.1| from Flexistipes sinusarabici DSM 4947

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336323954|ref|YP_004603921.1|
Domain Number 1 Region: 10-169
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 2.77e-26
Family MJ1460-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336323954|ref|YP_004603921.1|
Sequence length 172
Comment 4-vinyl reductase 4VR [Flexistipes sinusarabici DSM 4947]
Sequence
MSNQEYDFQWEHLGDIQDGRPNLGEMTSVATYRLMQYTLRDVLTKELGYEKALDILSKAG
MKAGEEFCRNMLDTSLEMNDFIEHLKDVLIELKMGVLRVEKMDIDSLKMVFTMSEDLDCS
GLPIIGVEFCDYDEGFIAGILKVYTGHTFNVKEVDCWATGERICRFKIDLAE
Download sequence
Identical sequences F8E9M4
WP_013886826.1.54234 gi|336323954|ref|YP_004603921.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]