SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2001440361 from Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2001440361
Domain Number 1 Region: 16-84
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000322
Family SinR domain-like 0.059
Further Details:      
 
Weak hits

Sequence:  2001440361
Domain Number - Region: 97-149
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.0698
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2001440361
Sequence length 170
Comment Predicted transcriptional regulators [Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2]
Sequence
MKVFQKQNRRYRSMTTQKLYAGTKLRETRTRLGLTQKAFAGKLGVSLPYLNQMENNNRPL
STTVVLSLAQEFGFDVTELSTGDAERLVSDMREALADPVFAEIAPPLADLRLTASNAPAL
ARAFLELHRAYRQTHERLASLDEALGREDARIQPSLGTRAHIFDTRPNQK
Download sequence
Identical sequences 2001440361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]