SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2001460052 from Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2001460052
Domain Number 1 Region: 7-31,64-170
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.94e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.0027
Further Details:      
 
Domain Number 2 Region: 158-191
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000733
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2001460052
Sequence length 204
Comment Sulfite reductase, beta subunit (hemoprotein) [Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2]
Sequence
MFKARIKILVEALGPEVFIAEVEEEFEAIRDSELQLPEAEIARIRSFFDTPRIDHPAPLP
EAGEPGFRHWLRRNRRDHKVEGLSSVVISLKPVGGTPGDATADQLDIIADLTERYGLDEL
RVTPEQNLLLPHVRNEDLHALWLALKASGLATPNAGLATDIVSCPGMDYCSLATARSIPI
AQAISERLEAAGLSEAAGRARADS
Download sequence
Identical sequences 2001460052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]