SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2001462296 from Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2001462296
Domain Number 1 Region: 1-43
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000048
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0086
Further Details:      
 
Weak hits

Sequence:  2001462296
Domain Number - Region: 24-87
Classification Level Classification E-value
Superfamily MoeA N-terminal region -like 0.0981
Family MoeA N-terminal region -like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2001462296
Sequence length 126
Comment Sulfite reductase, beta subunit (hemoprotein) [Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2]
Sequence
VWNTIGRRDNKYKARIKITVHENGIEKMQELVEARFSELRPQFTGVDQEMLKEIEAQFTA
PDFKTAPTDGFDQAYANDPVFRSWIDTNITAHRNADYAIVSISIKNHGETPGDATAEQML
DRFLIH
Download sequence
Identical sequences 2001462296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]