SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2001471698 from Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2001471698
Domain Number 1 Region: 10-84
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.00000000795
Family D-glucarate dehydratase-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2001471698
Sequence length 87
Comment [Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2]
Sequence
VDTALQLNRKKPVVLSSAFESGVGLAAITRYAAAYSGAGVPVGLDTYRFLAEDVLMNPLP
LDRPEIKVGDVVAAGALVDLDRIEAVS
Download sequence
Identical sequences 2001471698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]