SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2001477362 from Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2001477362
Domain Number 1 Region: 68-232
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.14e-41
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00054
Further Details:      
 
Domain Number 2 Region: 1-67
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.83e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2001477362
Sequence length 274
Comment Sulfite reductase, beta subunit (hemoprotein) [Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2]
Sequence
MQRIKIPFGGLNSVQLRRLADVSDKYASGFMHLTTRQDVQLYYIQLDTEPNMMRELADVG
ITTREACGNTVRNVTACHQAGTSPSDNFDVTPYAGAFKNFMLRNPICQNMGRKFKVCFEG
CHDKDHAGIMIHDLGFRARVKEIDGELKRGFQVYVGGGLGASPSLGHLWTEFLPVEEMIP
FSASVIRIFDRFGERKVRMKARMKFLIRKLGIDEFRENVDDERAKLNVDPRWNDFLNEID
ETSAETNLNIPSGTQGVESDTSYKAWTDSAVYSW
Download sequence
Identical sequences 2001477362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]