SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2001478362 from Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2001478362
Domain Number 1 Region: 201-259
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000000218
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0084
Further Details:      
 
Domain Number 2 Region: 3-73
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.00000353
Family D-glucarate dehydratase-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2001478362
Sequence length 267
Comment Enzyme involved in the deoxyxylulose pathway of isoprenoid biosynthesis [Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2]
Sequence
MDAAEAFGKIRKQVDVPLVADIHYDYKIALAVAEQGVDCLRINPGNIGREDRIKAVIQCA
KDNGLPIRIGVNAGSLEKELQRKYGEPTSDALVESALRHADILDRYDFQNFKVSVKASNV
FMTLQAYRKLSSQLEQPLHLGVTEAGTFRSGTVKSAVALGSLLMEGIGDTIRVSLAADPV
EEVRVGFDILKSLNLRKKGVNIIACPSCSRQNFDVIKTVNELEARLEDINESVDLAANGC
LVNGPGEGREVDVGLTGVTPIIGLPRR
Download sequence
Identical sequences 2001478362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]