SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2001440936 from Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2001440936
Domain Number 1 Region: 41-112
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000000000011
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00046
Further Details:      
 
Weak hits

Sequence:  2001440936
Domain Number - Region: 1-30
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.00138
Family Duplicated SiR/NiR-like domains 1 and 3 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2001440936
Sequence length 140
Comment Sulfite reductase, beta subunit (hemoprotein) [Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2]
Sequence
MTTNQNLQLTHVEEHEREQISWRLDDLGLSQRLKPDLQAAHMLSCVAFPTCGLAMAEAER
YMSDPLDLFNRLKQQYGLRQVPITLRVTGYPNGCARPYLAEIALTAALRDSTTYTWAAVL
TATDSTVCTPATSMKAFSLT
Download sequence
Identical sequences Q0VMM5
gi|110834986|ref|YP_693845.1| 393595.ABO_2125 2001440936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]