SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2004009955 from Human Gut Community Subject 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2004009955
Domain Number 1 Region: 8-120,221-314
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.35e-36
Family MraW-like putative methyltransferases 0.00052
Further Details:      
 
Domain Number 2 Region: 121-221
Classification Level Classification E-value
Superfamily Putative methyltransferase TM0872, insert domain 3.01e-32
Family Putative methyltransferase TM0872, insert domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2004009955
Sequence length 343
Comment Predicted S-adenosylmethionine-dependent methyltr ansferase involved in cell envelope biogenesis [Human Gut Community Subject 7]
Sequence
MTDVTTIHQPVLLRDCVDLVAPALAKPGSIAVDCTLGLAGHSTAFLKASPNARLIGIDRD
TEALALATKRMEMEGLADRFTPVHAAFDDFSQVLSDQGVDKVNAVFMDLGLSSLQIDETE
RGFSYSHDAPLDMRMDVTQPLTAEQVLAEYSFADLVRIFRAYGEERFSKQIAREIVRRRE
TEPLTTSGQLNRLVDEVVPQAHRPAGNPAKRVFQALRIEVNGELDKLAGTLPQIANHLAV
GGRLVVESYHSLEDKTVKAFMNQGLKVDAPADMPVVPPDMMPFFKELTRGAIKADAEEIA
NNPRSASVRLRAVELTRPIPARWRKRFDQGADYASMTRQGRRD
Download sequence
Identical sequences A0A1X2ZCW2 A1A2F7
367928.BAD_1109 gi|119026127|ref|YP_909972.1| 2004009955 WP_011743449.1.36503 WP_011743449.1.55335 WP_011743449.1.64668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]