SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2014260886 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP1 from Alice Springs, Crater Hills

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2014260886
Domain Number 1 Region: 1-218
Classification Level Classification E-value
Superfamily Triosephosphate isomerase (TIM) 7.85e-42
Family Triosephosphate isomerase (TIM) 0.00000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2014260886
Sequence length 232
Comment YNP1_104280 triosephosphate isomerase (EC 5.3.1.1) [Hot spring microbial community from Yellowstone Hot Springs, sample from Alice Springs, Crater Hills]
Sequence
MKKPIILINFKAYENSFGKKGVDIAKRIEKISIEYSTEVILSVPATMIPILSQEVSLPIY
AQHVDSYPLGAHTGSLLPEMIKEAGAKGTLLNHSEKRIRADEIHDALLRLNKLGLESVVC
VDRYELVEPMAILRPTAILIEPPELIGSGISVSKAKPEVITNAVKEISKVPGVFLIAGAG
ISNGEDVYTAVKLGADGIGVASAVMKAKEPEKVVEDFIKSGIKAMDERNDRN
Download sequence
Identical sequences F4B8R6
WP_013775702.1.74519 gi|332796584|ref|YP_004458084.1| 2014260886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]