SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2014373880 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2014373880
Domain Number 1 Region: 96-188
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000112
Family Internalin LRR domain 0.014
Further Details:      
 
Weak hits

Sequence:  2014373880
Domain Number - Region: 1-58
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0409
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2014373880
Sequence length 203
Comment YNP7_386760 Leucine Rich Repeat./PASTA domain. [Hot spring microbial community from Yellowstone Hot Springs, sample from Chocolate Pots]
Sequence
VPNLAGMTRSDAENALTAAGLVPDYPFYTCSLIFPPDHVAHQNPAAGTSGLPGTTIYFGL
ATGGCDDPITIADTRLNEILRELYNITDPATPLIRQQLLGLVSLDIPGEGITSLSGLEAA
RNLQSLYVSNNLIADVSPLAGLDILRHLDIENNQVTDLSPLALGTTFSKPSELFPRVLAC
TGNPLSSDSINIYIPHLIARGWT
Download sequence
Identical sequences 2014373880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]