SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2014295685 from Hot spring microbial community from Yellowstone Hot Springs, sample YNP9 from Dragon Spring, Norris Geyser Basin

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2014295685
Domain Number 1 Region: 25-93
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.0000000000000852
Family 2Fe-2S ferredoxin-related 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2014295685
Sequence length 96
Comment YNP9_112160 Ferredoxin [Hot spring microbial community from Yellowstone Hot Springs, sample from Dragon Spring, Norris Geyser Basin]
Sequence
MAKLIVNKKVIGNFDVGTKFQDIHDLIEKAGVEFGCTDGQCGVCVATVLRGLEALNEVSE
KESDTLWRIGEYDEDRRLTCQLEIVKDTDVIELQTD
Download sequence
Identical sequences B4U621 M1RLR3
380749.HY04AAS1_1528 gi|452944682|ref|YP_007500847.1| WP_012514567.1.45798 WP_012514567.1.67077 WP_012514567.1.67908 WP_012514567.1.87448 WP_012514567.1.9515 gi|471265050|ref|YP_007647904.1| 2014012734 gi|195953899|ref|YP_002122189.1| 2014295685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]