SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2044460768 from Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2044460768
Domain Number 1 Region: 11-70
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000196
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2044460768
Sequence length 106
Comment MGB_1460310 PASTA domain. [Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthus x giganteus)]
Sequence
VTLIVSQGPPQVTVPNVVGMSQSEAEALLHSKNLQVDAHTVPNDQPEGTVVAQSPNADEL
VDVNTVVRINVATGPQPVGVPNXIGRSYSDALAELQSLGFAVSRQD
Download sequence
Identical sequences 2044460768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]