SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2005137957 from simHC - Simulated High Complexity Metagenome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2005137957
Domain Number 1 Region: 1-302
Classification Level Classification E-value
Superfamily Phase 1 flagellin 3.92e-58
Family Phase 1 flagellin 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2005137957
Sequence length 302
Comment AFcontig_478_61_969 flagellar hook-associated protein 3 [simHC - Simulated High Complexity Metagenome]
Sequence
MLGRVTQRSIATNALTNLQNTQTRMAKLQEQITSGNSLPKGSEDSVRAAAALRLNDQIAV
NTENGRNLDEARAWMVTQEPALESTTKALQKVRELTVRASNGTFDATARKAIAAEITALK
ETILGDANTQYQGRAVFAGTSAGTVAYDATTYASNDDTNTTVTPAVGVVTRTVSPGVHMQ
VNISGNSVYGSGNDSLFAELDTLAQKITDGDPTAAASLSTIDGRITKATNAMATIGARTN
QLDHAEEVNANQLAYLEAQLNDVQGVDPAKAYVEFTQQNVAYQAALQVTAKTVQTSLLDF
LR
Download sequence
Identical sequences A6W8G8
gi|152965587|ref|YP_001361371.1| WP_011981754.1.7041 266940.Krad_1621 2005137957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]