SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2005153875 from simHC - Simulated High Complexity Metagenome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2005153875
Domain Number 1 Region: 7-64
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000136
Family Arginine repressor (ArgR), N-terminal DNA-binding domain 0.0095
Further Details:      
 
Domain Number 2 Region: 79-146
Classification Level Classification E-value
Superfamily C-terminal domain of arginine repressor 0.0000000000000116
Family C-terminal domain of arginine repressor 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2005153875
Sequence length 159
Comment AFACGS3071.b1_242_721 arginine repressor [simHC - Simulated High Complexity Metagenome]
Sequence
MAMASAPVDKSTRQNLILRLISERDLGTQQDVVRALAEEGVEVAQATVSRDLAELGVLKV
GNRYLALPHEPGSASIEVLPSFVLGLTPAQNLVVIHTRDGTAGAVSSVLDRVKGLKIVGT
IAGQDTVLAVTPDSAAAEEVASLIADVCRAKTRPAGSVE
Download sequence
Identical sequences Q1AS33
2005153875 gi|108805670|ref|YP_645607.1| 266117.Rxyl_2884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]