SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2005168270 from simHC - Simulated High Complexity Metagenome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2005168270
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily GlnB-like 1.97e-37
Family Prokaryotic signal transducing protein 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2005168270
Sequence length 110
Comment AFAHYU1970.x1_215_547 nitrogen regulatory protein P-II [simHC - Simulated High Complexity Metagenome]
Sequence
MKLIKAIIKPERLDAVKKALEDAGYFGMTITEVQGRGEQKGISLQYRGGTIEVDLIPKIE
MEILVSADKVDHVIETIKKGAYTGKIGDGRIFVIPVDASIKIRTGEVITE
Download sequence
Identical sequences A0A1V5SM61 Q2FS32
WP_011449463.1.85653 2005417155 2005168270 323259.Mhun_2505 gi|88603746|ref|YP_503924.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]