SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2005227514 from simHC - Simulated High Complexity Metagenome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2005227514
Domain Number 1 Region: 3-68
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 3.4e-20
Family TTHA0281-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2005227514
Sequence length 138
Comment AFAWON3620.g1_286_702 Uncharacterized conserved protein, COG1598 [simHC - Simulated High Complexity Metagenome]
Sequence
MKKERYVFPAIFTFDDDGITIEFPDLPGCISCADTLDEAVKNAKEVLGLYLWSMEKDNEQ
IPEPTPVNNLKLEQNQIPMLIEVWMPLVRHEMDNKAVKKTLTIPQWLNMLAEKHNINFSQ
VLQEALKDKLGIKDYKHN
Download sequence
Identical sequences A4XLA6
gi|146297111|ref|YP_001180882.1| 2005227514 351627.Csac_2108 WP_011917622.1.85531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]