SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2005425827 from simMC - Simulated Medium Complexity Metagenome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2005425827
Domain Number 1 Region: 5-88
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000275
Family Anti-sigma factor antagonist SpoIIaa 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2005425827
Sequence length 110
Comment AFAICB738.y1_493_825 Sulfate permease and related transporters (MFS superfamily) [simMC - Simulated Medium Complexity Metagenome]
Sequence
NVSEDANGWKVYKLNGPLFFGSVAEFLELFHAKTDPQDVIVDFQNSRVCDHSALEAIDTL
AERYVSAGKRLHLRHLSHDCKKLLHKAGDLVEVNLIEDPHYKVADDKLDS
Download sequence
Identical sequences 2005425827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]