SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2005405532 from simMC - Simulated Medium Complexity Metagenome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2005405532
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily RbcX-like 9.81e-44
Family RbcX-like 0.00000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2005405532
Sequence length 132
Comment AFAAWX14942.b1_70_468 RbcX protein. [simMC - Simulated Medium Complexity Metagenome]
Sequence
MNLKQIAKDTAKTLQSYLTYQALMTVLAQLGETNPPLALWLHTFSVGKVQDGEAYVKELF
REQPDLALRIMTVREHIAEEVAEFLPEMVRSGIQQANMEQRRQHLERMTHLSLSNPSPES
EQQTISDTDWDH
Download sequence
Identical sequences A0A1W5CLZ2 A0A1Z4KTZ8 O86418 Q3M675 Q798D4
2005405532 359436 NsR16 WP_010995694.1.33676 gi|17229017|ref|NP_485565.1| gi|75910110|ref|YP_324406.1| 103690.alr1525 240292.Ava_3906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]