SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2005452293 from simMC - Simulated Medium Complexity Metagenome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2005452293
Domain Number 1 Region: 11-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.28e-16
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2005452293
Sequence length 109
Comment AFAXBY4165.y1_247_576 anti-anti-sigma factor [simMC - Simulated Medium Complexity Metagenome]
Sequence
MSRAGGKQAQLESTGEAGRFQLSGDLSFETVPGLWAEAERLFRGSGDVELDLGAVARTDS
AGLALLVALTRRAAQHDQAIRFCHFPEQLRAMARLSGLADFLQLAPEKA
Download sequence
Identical sequences Q0A6H6
gi|114321368|ref|YP_743051.1| WP_011629955.1.71132 2005452293 187272.Mlg_2219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]