SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2005463477 from simMC - Simulated Medium Complexity Metagenome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2005463477
Domain Number 1 Region: 138-207
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.00000282
Family MJ1460-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2005463477
Sequence length 212
Comment AFBCSB9875.b1_166_804 hypothetical protein [simMC - Simulated Medium Complexity Metagenome]
Sequence
MTSVEAFRGLYYPNKIGRLCFLSLEEVMGQNGVKALLRLADLQQYIDAYPPNDLKREFPF
EAISKYSVALGTMYGPRGARGLELRAGRVAFSLGLKEFGPLLGMADLALKLMPITMKLKI
VLNATAQTFDRFSDQSSHVEEERGRFVYHITRCSNCITRPEPGPVFYIARGILEEATAWV
SGGRRFAVEQLSCMGQGNCSSCAFAIGKDPLE
Download sequence
Identical sequences A9WDP1
392886 324602.Caur_0397 480224.Chy400_0423 WP_012256303.1.35445 YP_001634036.1.55443 gi|222523717|ref|YP_002568187.1| 2005463477 gi|163845992|ref|YP_001634036.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]