SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2005469583 from simMC - Simulated Medium Complexity Metagenome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2005469583
Domain Number 1 Region: 3-185
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.33e-32
Family Phosphate binding protein-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2005469583
Sequence length 192
Comment AFLAP19173.x1_54_632 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [simMC - Simulated Medium Complexity Metagenome]
Sequence
MRFLPGLICLLPLLSPLAHAELIDDVNDRGELRIALEANTPPFNFKDGDTLTGFEVELGQ
LLANELDVRADFIVTDEADLLQGVESGKYDVALNHIALTPELKDRFDVSEPYTQVNAQLL
AKKDEQPRPMVLVQTLTEEKPKIGPPVELAIPFQKGNPAFHASLENALQRIRADGRLEAL
SKKWLSVQATEN
Download sequence
Identical sequences Q3K528
2005469583 gi|77461610|ref|YP_351117.1| WP_011336432.1.2668 205922.Pfl01_5389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]