SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431926797|ref|YP_007239831.1| from Pseudomonas stutzeri RCH2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431926797|ref|YP_007239831.1|
Domain Number 1 Region: 522-772
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.67e-63
Family Tandem AAA-ATPase domain 0.0000509
Further Details:      
 
Domain Number 2 Region: 300-521
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.32e-58
Family Tandem AAA-ATPase domain 0.00000692
Further Details:      
 
Weak hits

Sequence:  gi|431926797|ref|YP_007239831.1|
Domain Number - Region: 61-114
Classification Level Classification E-value
Superfamily FlgN-like 0.0051
Family FlgN-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|431926797|ref|YP_007239831.1|
Sequence length 776
Comment DNA/RNA helicase [Pseudomonas stutzeri RCH2]
Sequence
MAPPLAPRKERLIDDLRPVPLLSLGSHLATNYQPGNQRMVSEHQHRAGLSFIYGDACVHG
KRDGERIRHLAGDELQLIARHAQAEQALRKHLEQLGFRPALRQSLALPKDSAEMFQLPGE
EAWLGFVQQQLPELRRQGWQIDIHPGFAYDLAAIDSWYAEIDESADDDWFDLDLGIVVDG
QRIGILPVLLRLIRQNPQLLTPRALAQRSGEEQLRVQLDRPGQRDGQTLQVALPFARIKP
ILATLGELYLREPMDGASLRLSKADGARLAGLEELRPDWRGGERLRRFAGRLNSPSAQAC
PAPDALNATLRPYQLQGLAWMQTLRELGAGGILGDDMGLGKTLQSIAHILVEKQAGRLDR
PALVVMPTSLIPNWQDEARRFAPQLRVLTLTGTSRQKHFGELGEHDLLLTSYALLTRDIA
VLREQPLHVLILDEAQHIKNPSSKAAQAARALQTRQRLCLTGTPLENHLGELWSLYHFLM
PGWLGDAKRFTQDYRNPIEKHADEPRLAHLRARVRPFLLRRTKEQVATELPAKNEFVHWV
ELNDAQRELYETLRLAMDRKVRDEIERKGLARSQMVILEALLKLRQVCCDLRLLKGESTR
AIRGSSSGKLDSLLEMLDELMSEGRRVLLFSQFTSMLALIEQALHKRGIAYVKLTGETDD
RRTPVERFQAGEVPLFLISLKAGGTGLNLTAADTVIHYDPWWNPAAENQATDRAYRIGQD
KPVFVYRLITRGTVEERIRQLQARKAELAAGVLEGSGDAGWQLGEQDIDALFAPLP
Download sequence
Identical sequences L0GJL8
gi|431926797|ref|YP_007239831.1| WP_015276507.1.47231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]